peptides


Namepeptides JSON
Version 0.3.4 PyPI version JSON
download
home_pagehttps://github.com/althonos/peptides.py
SummaryPhysicochemical properties, indices and descriptors for amino-acid sequences.
upload_time2024-09-09 11:51:45
maintainerNone
docs_urlNone
authorMartin Larralde
requires_python>=3.6
licenseMIT
keywords bioinformatics protein sequence peptide qsar
VCS
bugtrack_url
requirements No requirements were recorded.
Travis-CI No Travis.
coveralls test coverage No coveralls.
            # `peptides.py` [![Stars](https://img.shields.io/github/stars/althonos/peptides.py.svg?style=social&maxAge=3600&label=Star)](https://github.com/althonos/peptides.py/stargazers)

*Physicochemical properties, indices and descriptors for amino-acid sequences.*

[![Actions](https://img.shields.io/github/actions/workflow/status/althonos/peptides.py/test.yml?branch=main&logo=github&style=flat-square&maxAge=300)](https://github.com/althonos/peptides.py/actions)
[![Coverage](https://img.shields.io/codecov/c/gh/althonos/peptides.py?style=flat-square&maxAge=3600)](https://codecov.io/gh/althonos/peptides.py/)
[![License](https://img.shields.io/badge/license-GPLv3-blue.svg?style=flat-square&maxAge=2678400)](https://choosealicense.com/licenses/gpl-3.0/)
[![PyPI](https://img.shields.io/pypi/v/peptides.svg?style=flat-square&maxAge=3600)](https://pypi.org/project/peptides)
[![Bioconda](https://img.shields.io/conda/vn/bioconda/peptides?style=flat-square&maxAge=3600&logo=anaconda)](https://anaconda.org/bioconda/peptides)
[![Wheel](https://img.shields.io/pypi/wheel/peptides.svg?style=flat-square&maxAge=3600)](https://pypi.org/project/peptides/#files)
[![Python Versions](https://img.shields.io/pypi/pyversions/peptides.svg?style=flat-square&maxAge=3600)](https://pypi.org/project/peptides/#files)
[![Python Implementations](https://img.shields.io/badge/impl-universal-success.svg?style=flat-square&maxAge=3600&label=impl)](https://pypi.org/project/peptides/#files)
[![Source](https://img.shields.io/badge/source-GitHub-303030.svg?maxAge=2678400&style=flat-square)](https://github.com/althonos/peptides.py/)
[![Mirror](https://img.shields.io/badge/mirror-EMBL-009f4d?style=flat-square&maxAge=2678400)](https://git.embl.de/larralde/peptides.py/)
[![GitHub issues](https://img.shields.io/github/issues/althonos/peptides.py.svg?style=flat-square&maxAge=600)](https://github.com/althonos/peptides.py/issues)
[![Docs](https://img.shields.io/readthedocs/peptides/latest?style=flat-square&maxAge=600)](https://peptides.readthedocs.io)
[![Changelog](https://img.shields.io/badge/keep%20a-changelog-8A0707.svg?maxAge=2678400&style=flat-square)](https://github.com/althonos/peptides.py/blob/master/CHANGELOG.md)
[![Downloads](https://img.shields.io/pypi/dm/peptides?style=flat-square&color=303f9f&maxAge=86400&label=downloads)](https://pepy.tech/project/peptides)

## πŸ—ΊοΈ Overview

`peptides.py` is a pure-Python package to compute common descriptors for
protein sequences. It started as a port of [`Peptides`](https://cran.r-project.org/web/packages/Peptides/index.html), the R package written by
[Daniel Osorio](https://orcid.org/0000-0003-4424-8422), but now also provides
some additional features from [EMBOSS](http://emboss.bioinformatics.nl/cgi-bin/emboss/),
[ExPASy Protein Identification and Analysis Tools](https://web.expasy.org/protparam/), and [Rcpi](https://bioconductor.org/packages/release/bioc/html/Rcpi.html).

This library has no external dependency and is available for all modern Python
versions (3.6+).

### πŸ“‹ Features

A non-exhaustive list of available features:

- Peptide statistics: amino acid counts and frequencies.
- **QSAR** descriptors: BLOSUM indices, Cruciani properties, FASGAI vectors, Kidera factors, Atchley factors, MS-WHIM scores, PCP descriptors, ProtFP descriptors, Sneath vectors, ST-scales, T-scales, VHSE-scales, Z-scales.
- Sequence profiles: hydrophobicity, hydrophobic moment, membrane position.
- Physicochemical properties: aliphatic index, instability index, theoretical net charge, isoelectric point, molecular weight (with isotope labelling support).
- Biological properties: structural class prediction.

*If this library is missing a useful statistic or descriptor, feel free to
reach out and open a feature request on the [issue tracker](https://github.com/althonos/peptides.py/issues)
of the [project repository](https://github.com/althonos/peptides.py).*

### 🧊 Vectorization

Most of the descriptors for a protein sequence are simple averages of values
taken in a lookup table, so computing them can be done in a vectorized manner.
If [`numpy`](https://numpy.org/) can be imported, relevant functions
(like `numpy.sum` or `numpy.take`) will be used, otherwise a fallback
implementation using [`array.array`](https://docs.python.org/3/library/array.html#array.array)
from the standard library is available.

## πŸ”§ Installing

Install the `peptides` package directly from [PyPi](https://pypi.org/project/peptides)
which hosts universal wheels that can be installed with `pip`:
```console
$ pip install peptides
```

Otherwise, `peptides.py` is also available as a [Bioconda](https://bioconda.github.io/)
package:
```console
$ conda install -c bioconda peptides
```

## πŸ“– Documentation

A complete [API reference](https://peptides.readthedocs.io/en/stable/api.html)
can be found in the [online documentation](https://peptides.readthedocs.io/),
or directly from the command line using
[`pydoc`](https://docs.python.org/3/library/pydoc.html):
```console
$ pydoc peptides.Peptide
```

## πŸ’‘ Example

Start by creating a `Peptide` object from a protein sequence:
```python
>>> import peptides
>>> peptide = peptides.Peptide("MLKKRFLGALAVATLLTLSFGTPVMAQSGSAVFTNEGVTPFAISYPGGGT")
```

Then use the appropriate methods to compute the descriptors you want:
```python
>>> peptide.aliphatic_index()
89.8...
>>> peptide.boman()
-0.2097...
>>> peptide.charge(pH=7.4)
1.99199...
>>> peptide.isoelectric_point()
10.2436...
```

Methods that return more than one scalar value (for instance, `Peptide.blosum_indices`)
will return a dedicated named tuple:
```python
>>> peptide.ms_whim_scores()
MSWHIMScores(mswhim1=-0.436399..., mswhim2=0.4916..., mswhim3=-0.49200...)
```

Use the `Peptide.descriptors` method to get a dictionary with every available
descriptor. This makes it very easy to create a `pandas.DataFrame` with
descriptors for several protein sequences:
```python
>>> seqs = ["SDKEVDEVDAALSDLEITLE", "ARQQNLFINFCLILIFLLLI", "EGVNDNECEGFFSAR"]
>>> df = pandas.DataFrame([ peptides.Peptide(s).descriptors() for s in seqs ])
>>> df
    BLOSUM1   BLOSUM2  BLOSUM3   BLOSUM4  ...        Z2        Z3        Z4        Z5
0  0.367000 -0.436000   -0.239  0.014500  ... -0.711000 -0.104500 -1.486500  0.429500
1 -0.697500 -0.372500   -0.493  0.157000  ... -0.307500 -0.627500 -0.450500  0.362000
2  0.479333 -0.001333    0.138  0.228667  ... -0.299333  0.465333 -0.976667  0.023333

[3 rows x 66 columns]
```

## πŸ’­ Feedback

### ⚠️ Issue Tracker

Found a bug ? Have an enhancement request ? Head over to the [GitHub issue
tracker](https://github.com/althonos/peptides.py/issues) if you need to report
or ask something. If you are filing in on a bug, please include as much
information as you can about the issue, and try to recreate the same bug
in a simple, easily reproducible situation.

### πŸ—οΈ Contributing

Contributions are more than welcome! See
[`CONTRIBUTING.md`](https://github.com/althonos/peptides.py/blob/main/CONTRIBUTING.md)
for more details.

## βš–οΈ License

This library is provided under the [GNU General Public License v3.0](https://choosealicense.com/licenses/gpl-3.0/).
The original R `Peptides` package was written by [Daniel Osorio](https://orcid.org/0000-0003-4424-8422),
[Paola RondΓ³n-Villarreal](https://orcid.org/0000-0001-8209-3885) and
[Rodrigo Torres](https://orcid.org/0000-0003-1113-3020), and is licensed under
the terms of the [GNU General Public License v2.0](https://choosealicense.com/licenses/gpl-2.0/).
The [EMBOSS](http://emboss.bioinformatics.nl/cgi-bin/emboss/) applications are
released under the [GNU General Public License v1.0](https://www.gnu.org/licenses/old-licenses/gpl-1.0.html).

*This project is in no way not affiliated, sponsored, or otherwise endorsed
by the [original `Peptides` authors](https://github.com/dosorio). It was developed
by [Martin Larralde](https://github.com/althonos/) during his PhD project
at the [European Molecular Biology Laboratory](https://www.embl.de/) in
the [Zeller team](https://github.com/zellerlab).*

            

Raw data

            {
    "_id": null,
    "home_page": "https://github.com/althonos/peptides.py",
    "name": "peptides",
    "maintainer": null,
    "docs_url": null,
    "requires_python": ">=3.6",
    "maintainer_email": null,
    "keywords": "bioinformatics, protein, sequence, peptide, qsar",
    "author": "Martin Larralde",
    "author_email": "martin.larralde@embl.de",
    "download_url": "https://files.pythonhosted.org/packages/c2/5a/871e514852764db28796d4b83bf327cfeab1211e400b2cdfa57cc5ee63d6/peptides-0.3.4.tar.gz",
    "platform": "posix",
    "description": "# `peptides.py` [![Stars](https://img.shields.io/github/stars/althonos/peptides.py.svg?style=social&maxAge=3600&label=Star)](https://github.com/althonos/peptides.py/stargazers)\n\n*Physicochemical properties, indices and descriptors for amino-acid sequences.*\n\n[![Actions](https://img.shields.io/github/actions/workflow/status/althonos/peptides.py/test.yml?branch=main&logo=github&style=flat-square&maxAge=300)](https://github.com/althonos/peptides.py/actions)\n[![Coverage](https://img.shields.io/codecov/c/gh/althonos/peptides.py?style=flat-square&maxAge=3600)](https://codecov.io/gh/althonos/peptides.py/)\n[![License](https://img.shields.io/badge/license-GPLv3-blue.svg?style=flat-square&maxAge=2678400)](https://choosealicense.com/licenses/gpl-3.0/)\n[![PyPI](https://img.shields.io/pypi/v/peptides.svg?style=flat-square&maxAge=3600)](https://pypi.org/project/peptides)\n[![Bioconda](https://img.shields.io/conda/vn/bioconda/peptides?style=flat-square&maxAge=3600&logo=anaconda)](https://anaconda.org/bioconda/peptides)\n[![Wheel](https://img.shields.io/pypi/wheel/peptides.svg?style=flat-square&maxAge=3600)](https://pypi.org/project/peptides/#files)\n[![Python Versions](https://img.shields.io/pypi/pyversions/peptides.svg?style=flat-square&maxAge=3600)](https://pypi.org/project/peptides/#files)\n[![Python Implementations](https://img.shields.io/badge/impl-universal-success.svg?style=flat-square&maxAge=3600&label=impl)](https://pypi.org/project/peptides/#files)\n[![Source](https://img.shields.io/badge/source-GitHub-303030.svg?maxAge=2678400&style=flat-square)](https://github.com/althonos/peptides.py/)\n[![Mirror](https://img.shields.io/badge/mirror-EMBL-009f4d?style=flat-square&maxAge=2678400)](https://git.embl.de/larralde/peptides.py/)\n[![GitHub issues](https://img.shields.io/github/issues/althonos/peptides.py.svg?style=flat-square&maxAge=600)](https://github.com/althonos/peptides.py/issues)\n[![Docs](https://img.shields.io/readthedocs/peptides/latest?style=flat-square&maxAge=600)](https://peptides.readthedocs.io)\n[![Changelog](https://img.shields.io/badge/keep%20a-changelog-8A0707.svg?maxAge=2678400&style=flat-square)](https://github.com/althonos/peptides.py/blob/master/CHANGELOG.md)\n[![Downloads](https://img.shields.io/pypi/dm/peptides?style=flat-square&color=303f9f&maxAge=86400&label=downloads)](https://pepy.tech/project/peptides)\n\n## \ud83d\uddfa\ufe0f Overview\n\n`peptides.py` is a pure-Python package to compute common descriptors for\nprotein sequences. It started as a port of [`Peptides`](https://cran.r-project.org/web/packages/Peptides/index.html), the R package written by\n[Daniel Osorio](https://orcid.org/0000-0003-4424-8422), but now also provides\nsome additional features from [EMBOSS](http://emboss.bioinformatics.nl/cgi-bin/emboss/),\n[ExPASy Protein Identification and Analysis Tools](https://web.expasy.org/protparam/), and [Rcpi](https://bioconductor.org/packages/release/bioc/html/Rcpi.html).\n\nThis library has no external dependency and is available for all modern Python\nversions (3.6+).\n\n### \ud83d\udccb Features\n\nA non-exhaustive list of available features:\n\n- Peptide statistics: amino acid counts and frequencies.\n- **QSAR** descriptors: BLOSUM indices, Cruciani properties, FASGAI vectors, Kidera factors, Atchley factors, MS-WHIM scores, PCP descriptors, ProtFP descriptors, Sneath vectors, ST-scales, T-scales, VHSE-scales, Z-scales.\n- Sequence profiles: hydrophobicity, hydrophobic moment, membrane position.\n- Physicochemical properties: aliphatic index, instability index, theoretical net charge, isoelectric point, molecular weight (with isotope labelling support).\n- Biological properties: structural class prediction.\n\n*If this library is missing a useful statistic or descriptor, feel free to\nreach out and open a feature request on the [issue tracker](https://github.com/althonos/peptides.py/issues)\nof the [project repository](https://github.com/althonos/peptides.py).*\n\n### \ud83e\uddca Vectorization\n\nMost of the descriptors for a protein sequence are simple averages of values\ntaken in a lookup table, so computing them can be done in a vectorized manner.\nIf [`numpy`](https://numpy.org/) can be imported, relevant functions\n(like `numpy.sum` or `numpy.take`) will be used, otherwise a fallback\nimplementation using [`array.array`](https://docs.python.org/3/library/array.html#array.array)\nfrom the standard library is available.\n\n## \ud83d\udd27 Installing\n\nInstall the `peptides` package directly from [PyPi](https://pypi.org/project/peptides)\nwhich hosts universal wheels that can be installed with `pip`:\n```console\n$ pip install peptides\n```\n\nOtherwise, `peptides.py` is also available as a [Bioconda](https://bioconda.github.io/)\npackage:\n```console\n$ conda install -c bioconda peptides\n```\n\n## \ud83d\udcd6 Documentation\n\nA complete [API reference](https://peptides.readthedocs.io/en/stable/api.html)\ncan be found in the [online documentation](https://peptides.readthedocs.io/),\nor directly from the command line using\n[`pydoc`](https://docs.python.org/3/library/pydoc.html):\n```console\n$ pydoc peptides.Peptide\n```\n\n## \ud83d\udca1 Example\n\nStart by creating a `Peptide` object from a protein sequence:\n```python\n>>> import peptides\n>>> peptide = peptides.Peptide(\"MLKKRFLGALAVATLLTLSFGTPVMAQSGSAVFTNEGVTPFAISYPGGGT\")\n```\n\nThen use the appropriate methods to compute the descriptors you want:\n```python\n>>> peptide.aliphatic_index()\n89.8...\n>>> peptide.boman()\n-0.2097...\n>>> peptide.charge(pH=7.4)\n1.99199...\n>>> peptide.isoelectric_point()\n10.2436...\n```\n\nMethods that return more than one scalar value (for instance, `Peptide.blosum_indices`)\nwill return a dedicated named tuple:\n```python\n>>> peptide.ms_whim_scores()\nMSWHIMScores(mswhim1=-0.436399..., mswhim2=0.4916..., mswhim3=-0.49200...)\n```\n\nUse the `Peptide.descriptors` method to get a dictionary with every available\ndescriptor. This makes it very easy to create a `pandas.DataFrame` with\ndescriptors for several protein sequences:\n```python\n>>> seqs = [\"SDKEVDEVDAALSDLEITLE\", \"ARQQNLFINFCLILIFLLLI\", \"EGVNDNECEGFFSAR\"]\n>>> df = pandas.DataFrame([ peptides.Peptide(s).descriptors() for s in seqs ])\n>>> df\n    BLOSUM1   BLOSUM2  BLOSUM3   BLOSUM4  ...        Z2        Z3        Z4        Z5\n0  0.367000 -0.436000   -0.239  0.014500  ... -0.711000 -0.104500 -1.486500  0.429500\n1 -0.697500 -0.372500   -0.493  0.157000  ... -0.307500 -0.627500 -0.450500  0.362000\n2  0.479333 -0.001333    0.138  0.228667  ... -0.299333  0.465333 -0.976667  0.023333\n\n[3 rows x 66 columns]\n```\n\n## \ud83d\udcad Feedback\n\n### \u26a0\ufe0f Issue Tracker\n\nFound a bug ? Have an enhancement request ? Head over to the [GitHub issue\ntracker](https://github.com/althonos/peptides.py/issues) if you need to report\nor ask something. If you are filing in on a bug, please include as much\ninformation as you can about the issue, and try to recreate the same bug\nin a simple, easily reproducible situation.\n\n### \ud83c\udfd7\ufe0f Contributing\n\nContributions are more than welcome! See\n[`CONTRIBUTING.md`](https://github.com/althonos/peptides.py/blob/main/CONTRIBUTING.md)\nfor more details.\n\n## \u2696\ufe0f License\n\nThis library is provided under the [GNU General Public License v3.0](https://choosealicense.com/licenses/gpl-3.0/).\nThe original R `Peptides` package was written by [Daniel Osorio](https://orcid.org/0000-0003-4424-8422),\n[Paola Rond\u00f3n-Villarreal](https://orcid.org/0000-0001-8209-3885) and\n[Rodrigo Torres](https://orcid.org/0000-0003-1113-3020), and is licensed under\nthe terms of the [GNU General Public License v2.0](https://choosealicense.com/licenses/gpl-2.0/).\nThe [EMBOSS](http://emboss.bioinformatics.nl/cgi-bin/emboss/) applications are\nreleased under the [GNU General Public License v1.0](https://www.gnu.org/licenses/old-licenses/gpl-1.0.html).\n\n*This project is in no way not affiliated, sponsored, or otherwise endorsed\nby the [original `Peptides` authors](https://github.com/dosorio). It was developed\nby [Martin Larralde](https://github.com/althonos/) during his PhD project\nat the [European Molecular Biology Laboratory](https://www.embl.de/) in\nthe [Zeller team](https://github.com/zellerlab).*\n",
    "bugtrack_url": null,
    "license": "MIT",
    "summary": "Physicochemical properties, indices and descriptors for amino-acid sequences.",
    "version": "0.3.4",
    "project_urls": {
        "Bug Tracker": "https://github.com/althonos/peptides.py/issues",
        "Builds": "https://github.com/althonos/peptides.py/actions",
        "Changelog": "https://github.com/althonos/peptides.py/blob/master/CHANGELOG.md",
        "Coverage": "https://codecov.io/gh/althonos/peptides.py/",
        "Homepage": "https://github.com/althonos/peptides.py",
        "PyPI": "https://pypi.org/project/peptides"
    },
    "split_keywords": [
        "bioinformatics",
        " protein",
        " sequence",
        " peptide",
        " qsar"
    ],
    "urls": [
        {
            "comment_text": "",
            "digests": {
                "blake2b_256": "c4cea4526cf3029462cd79ba87220bbd5ad3aba0927321a4d978a0e30f19032f",
                "md5": "688c072b90923493c14990f026a5b659",
                "sha256": "69ccca384d3e8df4577a1caf50f7e3687cf5c57a015706af045a1cb43e225edd"
            },
            "downloads": -1,
            "filename": "peptides-0.3.4-py3-none-any.whl",
            "has_sig": false,
            "md5_digest": "688c072b90923493c14990f026a5b659",
            "packagetype": "bdist_wheel",
            "python_version": "py3",
            "requires_python": ">=3.6",
            "size": 122070,
            "upload_time": "2024-09-09T11:51:43",
            "upload_time_iso_8601": "2024-09-09T11:51:43.676162Z",
            "url": "https://files.pythonhosted.org/packages/c4/ce/a4526cf3029462cd79ba87220bbd5ad3aba0927321a4d978a0e30f19032f/peptides-0.3.4-py3-none-any.whl",
            "yanked": false,
            "yanked_reason": null
        },
        {
            "comment_text": "",
            "digests": {
                "blake2b_256": "c25a871e514852764db28796d4b83bf327cfeab1211e400b2cdfa57cc5ee63d6",
                "md5": "0975781e534a3b196feca9fd78861a59",
                "sha256": "e4cd95c7aec68a1876d85bd544478d2d0106e1d884b515c861979dbe00e14a39"
            },
            "downloads": -1,
            "filename": "peptides-0.3.4.tar.gz",
            "has_sig": false,
            "md5_digest": "0975781e534a3b196feca9fd78861a59",
            "packagetype": "sdist",
            "python_version": "source",
            "requires_python": ">=3.6",
            "size": 73452,
            "upload_time": "2024-09-09T11:51:45",
            "upload_time_iso_8601": "2024-09-09T11:51:45.193704Z",
            "url": "https://files.pythonhosted.org/packages/c2/5a/871e514852764db28796d4b83bf327cfeab1211e400b2cdfa57cc5ee63d6/peptides-0.3.4.tar.gz",
            "yanked": false,
            "yanked_reason": null
        }
    ],
    "upload_time": "2024-09-09 11:51:45",
    "github": true,
    "gitlab": false,
    "bitbucket": false,
    "codeberg": false,
    "github_user": "althonos",
    "github_project": "peptides.py",
    "travis_ci": false,
    "coveralls": false,
    "github_actions": true,
    "lcname": "peptides"
}
        
Elapsed time: 0.32950s